GET /api/protein/UniProt/A0A9P4P444/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9P4P444",
"id": "A0A9P4P444_9PLEO",
"source_organism": {
"taxId": "1392251",
"scientificName": "Karstenula rhodostoma CBS 690.94",
"fullName": "Karstenula rhodostoma CBS 690.94"
},
"name": "Adenosine kinase",
"description": [
"ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives"
],
"length": 344,
"sequence": "MAKGNFELLALENPLLDIQGVGDEKLLEKYGLKADDAILAEEKHQGLFEDLIQNYNAVLIAGGAAQNSARGAQYILPEDSTVYIGCVGKDKYGQTLEDINKKAGVKTVYRYDEKAPTGRCGVVITGHHRSLCTDLAAANLYNVDHLKQPEVWKYVEGAKFFYVGGYHLTVSVPAILAIAEHAAANNKTFVLNLSAPFISQFFKDQLDSVLPYVDILIGNESEAAAYAESHDIASKDVKEIAKEIAKLPKKNSKKERTVVFTQGTDATITVTGSEAAEYPVHAISADKINDTNGAGDAFAGGFLAGIVSGDNLKTAVDKGQWLAKLSIQELGPSYPEPKQTYTSS",
"proteome": "UP000799764",
"gene": "P171DRAFT_449712",
"go_terms": [
{
"identifier": "GO:0004001",
"name": "adenosine kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006166",
"name": "purine ribonucleoside salvage",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016301",
"name": "kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15af1988c305a97f244d41de7ad5bb09a2fb2e9e",
"counters": {
"domain_architectures": 158989,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 2,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 158989
}
}
}