HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9P2HA09",
"id": "A0A9P2HA09_MYCTX",
"source_organism": {
"taxId": "611304",
"scientificName": "Mycobacterium tuberculosis variant africanum K85",
"fullName": "Mycobacterium tuberculosis variant africanum K85"
},
"name": "LexA repressor",
"description": [
"Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair"
],
"length": 217,
"sequence": "MLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV",
"proteome": null,
"gene": "lexA",
"go_terms": [
{
"identifier": "GO:0004252",
"name": "serine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009432",
"name": "SOS response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045892",
"name": "negative regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "80ebd7e7a187ff1e5bf9b0d007a9803b2e453c54",
"counters": {
"domain_architectures": 20379,
"entries": 20,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prints": 1,
"interpro": 9
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 20379
}
}
}