HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9P1NK31",
"id": "A0A9P1NK31_ECOLX",
"source_organism": {
"taxId": "762608",
"scientificName": "Escherichia coli ETEC 1392/75",
"fullName": "Escherichia coli ETEC 1392/75"
},
"name": "Dihydropteroate synthase",
"description": [
"Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives"
],
"length": 271,
"sequence": "MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR",
"proteome": null,
"gene": "ETEC1392/75_p62_00009",
"go_terms": [
{
"identifier": "GO:0042558",
"name": "pteridine-containing compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004156",
"name": "dihydropteroate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009396",
"name": "folic acid-containing compound biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "105f02382abc961b20a268efdde31f2846c9584c",
"counters": {
"domain_architectures": 33850,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"panther": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33850
}
}
}