GET /api/protein/UniProt/A0A9P1NK31/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9P1NK31",
        "id": "A0A9P1NK31_ECOLX",
        "source_organism": {
            "taxId": "762608",
            "scientificName": "Escherichia coli ETEC 1392/75",
            "fullName": "Escherichia coli ETEC 1392/75"
        },
        "name": "Dihydropteroate synthase",
        "description": [
            "Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives"
        ],
        "length": 271,
        "sequence": "MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR",
        "proteome": null,
        "gene": "ETEC1392/75_p62_00009",
        "go_terms": [
            {
                "identifier": "GO:0042558",
                "name": "pteridine-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004156",
                "name": "dihydropteroate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009396",
                "name": "folic acid-containing compound biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "105f02382abc961b20a268efdde31f2846c9584c",
        "counters": {
            "domain_architectures": 33850,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33850
        }
    }
}