GET /api/protein/UniProt/A0A9P0AIR2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9P0AIR2",
        "id": "A0A9P0AIR2_BEMTA",
        "source_organism": {
            "taxId": "7038",
            "scientificName": "Bemisia tabaci",
            "fullName": "Bemisia tabaci (Sweetpotato whitefly)"
        },
        "name": "Lysosomal dipeptide transporter MFSD1",
        "description": [
            "Lysosomal dipeptide uniporter that selectively exports lysine, arginine or histidine-containing dipeptides with a net positive charge from the lysosome lumen into the cytosol. Could play a role in a specific type of protein O-glycosylation indirectly regulating macrophages migration and tissue invasion. Also essential for liver homeostasis"
        ],
        "length": 537,
        "sequence": "MAVREPLLAAEDTEGDEISRIPSPVDDIESNGGAQNNGCCHPNGGCSRLFALVFMCVLGFGSYFCYDNPGALQDDFIDDMGLSTSEFVQLYSWYSWPNVILCFVGGFLIDRVFGIRFGTMLYAMLVCVGQLIFASGAFNNSLWIMIAGRFIFGIGGESLAVAQNNYAVLWFKGKELNLVFGFQMSFARVGSFVNFQVVEPLYHYVNKYYKGYECLGIVLFIASGTCLLSLISSAILAWMDKRAHHVNSANNQQQAEEVVRLTDIKDFPKSFWMVTFVIVTYYVAIFPFVALGKVFFERKFDLEPSQANFVNSIVYLIAGFLSPFIGLALDKTGCNVMWAFFSILGTIIGHSLLAFTFLNPYYGMVCMAVGYTTVSSTLWPIIGLIIPEYQLGTAYGIAQSVQNLGLALIAMLAGLIVDMGGYLMLECFFLFCLGLALMMIIFIWIHDYMTSGILNMTVKQREIYERNRLAAEILEHEKLLAAGSMSDITPHDLLQPHSDLLQPHSDLYIRNRFLSRIGASIPSHVMNPKGLAYRPLR",
        "proteome": "UP001152759",
        "gene": "BEMITA_LOCUS11130",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "04ed00d0ac42cc42b19f7796b389c797a27f88ba",
        "counters": {
            "domain_architectures": 1276664,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1276664
        }
    }
}