HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9N7TW64",
"id": "A0A9N7TW64_PLEPL",
"source_organism": {
"taxId": "8262",
"scientificName": "Pleuronectes platessa",
"fullName": "Pleuronectes platessa (European plaice)"
},
"name": "1-acyl-sn-glycerol-3-phosphate acyltransferase",
"description": [
"Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone"
],
"length": 270,
"sequence": "MDALWAIPLLLVPLLMWTSSTFVFYFKKCFYVAWMMVLGLVAIPMCILKSGGRDVENMRIIRVLVRHVKYFLGLRFEVSGWEHLQTEGPYVIISNHQSSLDVLGLMEILPDRCTMIAKKELIYAGTVGLICWLGGIVFINRKKTSDAKSVMAEAAKTMLDDQIRLWVFPEGTRNQKGDLLPFKKGAFHLAVQAQAPVIPIVFSSYNSFYLRKEKQFKSGTIRLQILPKIDTKGMTTDDVASLSDKSFNAMRSVFLDTCNSVPQSNGPSMR",
"proteome": "UP001153269",
"gene": "PLEPLA_LOCUS7683",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003841",
"name": "1-acylglycerol-3-phosphate O-acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "750765b0b4197ba78251d66d952d7551d731bd87",
"counters": {
"domain_architectures": 115965,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"smart": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 115965
}
}
}