GET /api/protein/UniProt/A0A9L0IV09/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9L0IV09",
        "id": "A0A9L0IV09_EQUAS",
        "source_organism": {
            "taxId": "9793",
            "scientificName": "Equus asinus",
            "fullName": "Equus asinus (Donkey)"
        },
        "name": "Protein S100-A13",
        "description": [
            "Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine"
        ],
        "length": 98,
        "sequence": "MAAEPLTELEAAIETVVTTFFTFAGREGRKGSLSVNEFKELATQQLPHLLKDVGSLDEKMKSLDVNQDSELKFHEYWRLIGELAKEIRKEKAQEIRKK",
        "proteome": "UP000694387",
        "gene": "S100A13",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9fbe415715d177c71b45cd24325edde000517727",
        "counters": {
            "domain_architectures": 10240,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10240
        }
    }
}