GET /api/protein/UniProt/A0A9K2KNJ0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9K2KNJ0",
        "id": "A0A9K2KNJ0_NEIM8",
        "source_organism": {
            "taxId": "604162",
            "scientificName": "Neisseria meningitidis serogroup C (strain 8013)",
            "fullName": "Neisseria meningitidis serogroup C (strain 8013)"
        },
        "name": "Formamidopyrimidine-DNA glycosylase",
        "description": [
            "Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates"
        ],
        "length": 275,
        "sequence": "MPELPEVETTLRGIAPHIEGKTVEAVVLRQLKLRWQINPDLGEILSGRQVLSCGRRAKYLLIRFQTGVLLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAILWYEGIEEHHPLLEKLGPEPLSEAFCADYLYARLKAQKRAVKLALMDNAVVVGVGNIYANESLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEYTVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK",
        "proteome": null,
        "gene": "mutM",
        "go_terms": [
            {
                "identifier": "GO:0003906",
                "name": "DNA-(apurinic or apyrimidinic site) endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019104",
                "name": "DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003684",
                "name": "damaged DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016799",
                "name": "hydrolase activity, hydrolyzing N-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008534",
                "name": "oxidized purine nucleobase lesion DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "80cde816fdd044952e2dc733f0e587d4b1b6f0f6",
        "counters": {
            "domain_architectures": 26807,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "profile": 2,
                "smart": 2,
                "cdd": 1,
                "cathgene3d": 2,
                "ssf": 3,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26807
        }
    }
}