GET /api/protein/UniProt/A0A9J7GY04/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9J7GY04",
"id": "A0A9J7GY04_CRIGR",
"source_organism": {
"taxId": "10029",
"scientificName": "Cricetulus griseus",
"fullName": "Cricetulus griseus (Chinese hamster)"
},
"name": "Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial",
"description": [
"Adapter protein that plays a role in different signaling pathways including TLRs and IL-1 pathways or innate antiviral induction signaling. Plays a role in the activation of NF-kappa-B by forming a signal complex with TRAF6 and TAK1/MAP3K7 to activate TAK1/MAP3K7 leading to activation of IKKs. Once ubiquitinated, interacts with the dissociated RELA and NFKB1 proteins and translocates to the nucleus where it induces NF-kappa-B-dependent gene expression. Plays a role in innate antiviral immune response by bridging the pattern recognition receptors RIGI and MDA5/IFIT1 to the MAVS complex at the mitochondrion. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development",
"As part of the MCIA complex, involved in the assembly of the mitochondrial complex I"
],
"length": 467,
"sequence": "MGWVQASLLVRGLSRGWGSICSTALSRAATTQVSLQAPRGLHCSAVIHKDDVSLVPRPPEPQRKPIKVPVLHEELFTPSATGEKDKASFLRALRSFEEHSVRKRGHVDFIYLALRKMPEFGVERDLSVYNLLLDVFPKEIFRPRNIIQRIFVHYPRQQECGISVLEQMERYAQVDLELLCCGAKPVLGLLIYVSSRPECWDYSSFICTGVMPNTETEFLLTQIFGRTSYPMLKFLRMKLWLTRFKNINPYPVPRDLPQDPLDLAKLSLRRMEPDLSAKVTVYQMSLPSDSTGTDPIQPHIVGIQSPDQQAALARHNPSKPVFVEGPFPLWLRNKCVYYHILRADLPLPEEEKVEEIPEEWNLYYPMKLDLEYSRSGWDNYEFDLDEVTEGPVFAMCMAGAHDQATLVKWIQGLQETNPILAQVPVVFRLARSTGELLTTSRLEEQSPPHGSPRDQEEDALQAQPQQG",
"proteome": "UP001108280",
"gene": "Ecsit",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e6f3fd9be91ed466d80ad69481e0a85657a43875",
"counters": {
"domain_architectures": 9,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"smart": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9
}
}
}