General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9J7FW25",
        "id": "A0A9J7FW25_CRIGR",
        "source_organism": {
            "taxId": "10029",
            "scientificName": "Cricetulus griseus",
            "fullName": "Cricetulus griseus (Chinese hamster)"
        },
        "name": "6-pyruvoyl tetrahydrobiopterin synthase",
        "description": [
            "Involved in the biosynthesis of tetrahydrobiopterin, an essential cofactor of aromatic amino acid hydroxylases. Catalyzes the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin"
        ],
        "length": 91,
        "sequence": "MAMDTTIKVDPVTGMVMNLTDLKEYMEEAIMKPLDHKNLDLDVPYFAGVVSTTENVAVYIWESLQKLLPTGVLYKVKVYETDNNIVVYKGE",
        "proteome": "UP001108280",
        "gene": "Pts",
        "go_terms": [
            {
                "identifier": "GO:0003874",
                "name": "6-pyruvoyltetrahydropterin synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006729",
                "name": "tetrahydrobiopterin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b7b83931495b826567c7e4e9909278c7cae393ce",
        "counters": {
            "domain_architectures": 23002,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23002
        }
    }
}