GET /api/protein/UniProt/A0A9J7EKB4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9J7EKB4",
"id": "A0A9J7EKB4_SPOLT",
"source_organism": {
"taxId": "69820",
"scientificName": "Spodoptera litura",
"fullName": "Spodoptera litura (Asian cotton leafworm)"
},
"name": "Splicing factor YJU2",
"description": [
"Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA. Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'-intermediates"
],
"length": 310,
"sequence": "MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCATCGEYIYKGKKFNARKEDVENEDYLGIRIYRFYIKCTRCLQEISFKTDPKNTDYEIEAGATRNFMALKLAEEQAKREEEEQKEEEANNPMKLLEYRTEQSKQEIETLEGLEELKELNRRQHAVDFEGMLKQYQPETSDERRAREEKEDDEFIKSIKFNNPSAKKVIAEEIIEEVKDEDDSGPPAKTSRIEIIPQRTSNVKKAESWNKSIGVLSKKSTLSNLVKSKKDSDSSIPTTTVSTDVTSKVATPASGLSLLANYSGSDSDSQ",
"proteome": "UP000301870",
"gene": "LOC111358577",
"go_terms": [
{
"identifier": "GO:0000398",
"name": "mRNA splicing, via spliceosome",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2809d1d6aebac7a708cb152ebb2d2bf5436c0132",
"counters": {
"domain_architectures": 9588,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9588
}
}
}