GET /api/protein/UniProt/A0A9J7EKB4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9J7EKB4",
        "id": "A0A9J7EKB4_SPOLT",
        "source_organism": {
            "taxId": "69820",
            "scientificName": "Spodoptera litura",
            "fullName": "Spodoptera litura (Asian cotton leafworm)"
        },
        "name": "Splicing factor YJU2",
        "description": [
            "Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA. Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'-intermediates"
        ],
        "length": 310,
        "sequence": "MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCATCGEYIYKGKKFNARKEDVENEDYLGIRIYRFYIKCTRCLQEISFKTDPKNTDYEIEAGATRNFMALKLAEEQAKREEEEQKEEEANNPMKLLEYRTEQSKQEIETLEGLEELKELNRRQHAVDFEGMLKQYQPETSDERRAREEKEDDEFIKSIKFNNPSAKKVIAEEIIEEVKDEDDSGPPAKTSRIEIIPQRTSNVKKAESWNKSIGVLSKKSTLSNLVKSKKDSDSSIPTTTVSTDVTSKVATPASGLSLLANYSGSDSDSQ",
        "proteome": "UP000301870",
        "gene": "LOC111358577",
        "go_terms": [
            {
                "identifier": "GO:0000398",
                "name": "mRNA splicing, via spliceosome",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2809d1d6aebac7a708cb152ebb2d2bf5436c0132",
        "counters": {
            "domain_architectures": 9588,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9588
        }
    }
}