GET /api/protein/UniProt/A0A9J6ZHK9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9J6ZHK9",
"id": "A0A9J6ZHK9_9BACL",
"source_organism": {
"taxId": "2994561",
"scientificName": "Candidatus Pristimantibacillus lignocellulolyticus",
"fullName": "Candidatus Pristimantibacillus lignocellulolyticus"
},
"name": "Xylose transport system permease protein XylH",
"description": [
"Part of the binding-protein-dependent transport system for D-xylose. Probably responsible for the translocation of the substrate across the membrane"
],
"length": 391,
"sequence": "MKLMHEAKNMLKTNIREYGMYIALFIIMLTFTILTDGLFLSSRNISNLLDATGYIAVLAVGMTLVIVIRHIDLSVGFAAGFMGAIAATMLTQLGVPVIITIPVILLLGIVVGFFNGFLVASIGIPSFVASLAAMLIFRGALLRVTEKSGTIMVKDETFNAIGNGYVPAIMKVMHLNLLSLIIGAIIIVLYIVSEFSKRKNKQKYNFEVMSKGMFAIKLVFISAIIAYITYILAGYKGFSWTVIIMLIVAVIYHFLTSSTVIGRHIYAVGSNPEAAHLSGINVKKITYIVFGSMGLLSALSGILFTARLQSATTTAGTLFELDAIAAAYVGGVSAAGGVGKVTGSIIGAIVMASLISGMNLLGVGISYQYIIRGGVLAVAVIFDVMTRRKRA",
"proteome": null,
"gene": "NAG76_03330",
"go_terms": [
{
"identifier": "GO:0022857",
"name": "transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1f4945418929b9761eda031e21626d80f6bb8489",
"counters": {
"domain_architectures": 257120,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 257120
}
}
}