GET /api/protein/UniProt/A0A9F2WKW1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9F2WKW1",
"id": "A0A9F2WKW1_PYTBI",
"source_organism": {
"taxId": "176946",
"scientificName": "Python bivittatus",
"fullName": "Python bivittatus (Burmese python)"
},
"name": "Dipeptidase",
"description": [
"Independently of its dipeptidase activity, acts as an adhesion receptor for neutrophil recruitment from bloodstream into inflamed lungs and liver"
],
"length": 417,
"sequence": "MLLLLLLLWVPYLAPAWLPLCSAEVYQLEAARIMNTTPVVDGHNDLPWQLLKKFNNQLSLKSASLYELEGTHTNIAKLRLGRVGAQFWAAYVPCDTQNKDAVKRTLEQIDVIHRMCHQYPDDFECVTDGASIQKTFGTRRVASLIGVEGGHSIDSSLAVLRTFYLLGVRYMTLTHSCNTPWADNWLVDTAEEQPVHNGLTEFGKRVVHEMNRLGMMVDLSHVSVETMKAALSISRAPVIFSHSSAYAICSNKRNVPDDVLRRVNETRSLVMVNFYNDYVSCSTSATLAQVADHMDYIKRIAGAKSVGIGGDYDGVPRVPLGLEDVSKYPDLIAELLRRKWTEEEVKDALANNLLRVLREVEKVRDEMAYERVAPDDAPIAFQELEGGCRTYYGYSNQGHHPRVLPAVFLLLLFSMLI",
"proteome": "UP000695026",
"gene": "DPEP1",
"go_terms": [
{
"identifier": "GO:0070573",
"name": "metallodipeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "953408cc0c31d3c7a00316ed8818609758801a0f",
"counters": {
"domain_architectures": 25490,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25490
}
}
}