General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9F2WIB7",
        "id": "A0A9F2WIB7_PYTBI",
        "source_organism": {
            "taxId": "176946",
            "scientificName": "Python bivittatus",
            "fullName": "Python bivittatus (Burmese python)"
        },
        "name": "Glutathione S-transferase omega",
        "description": [
            "Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA)"
        ],
        "length": 242,
        "sequence": "MSGEFARSLGKESAAPGPVPEGVIRLYSMRYCPFAQRTRLVLKAKGINHEIVNINLKNKPEWFFEKSPFGMVPVLETSKGQLIYESPITCEYLDEAYPEKKLYPVDPYEKAYQKMLLDYFSKLPPISHKHLLAIKNGEDTSALKNEYQEKLLKLEEILGKHKTKFFGGNSVSMIDYLIWPWFERMEAFQLLECLDHTPMLKCWVDVMKLDLAVQATITDPQICKGFLEQYLKNSPEACDYGL",
        "proteome": "UP000695026",
        "gene": "GSTO1",
        "go_terms": [
            {
                "identifier": "GO:0004364",
                "name": "glutathione transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10bb4d3050db7d07b36f77e609ac56fdfeb0e065",
        "counters": {
            "domain_architectures": 4337,
            "entries": 25,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "profile": 3,
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "sfld": 3,
                "prints": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4337
        }
    }
}