General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9F2R3C9",
        "id": "A0A9F2R3C9_PYTBI",
        "source_organism": {
            "taxId": "176946",
            "scientificName": "Python bivittatus",
            "fullName": "Python bivittatus (Burmese python)"
        },
        "name": "nucleoside diphosphate phosphatase",
        "description": [
            "Hydrolyzes nucleoside diphosphates with a preference for GDP, IDP and UDP compared to ADP and CDP. In the lumen of the endoplasmic reticulum, hydrolyzes UDP that acts as an end-product feedback inhibitor of the UDP-Glc:glycoprotein glucosyltransferases. UMP can be transported back by an UDP-sugar antiporter to the cytosol where it is consumed to regenerate UDP-glucose. Therefore, it positively regulates protein reglucosylation by clearing UDP from the ER lumen and by promoting the regeneration of UDP-glucose. Protein reglucosylation is essential to proper glycoprotein folding and quality control in the ER"
        ],
        "length": 428,
        "sequence": "MMGISWFTVTAIFAFSSIYCIVSHPKPELWFQNLYPLKMCPANASVGTFYGIMFDAGSTGTRIHIYTFIQRSPENPAELKGEVFESVKPGLSAYADQPKKGAETIRKLLEMAKSAVPPSHWSKTPVVLKATAGLRLLAEHKAQALLSQVRVVFEDSPFLVPDNSVSIMDGSYEGILAWITVNFLTGQLYGQDQQTVGTLDLGGASTQITFLPQLEETLAQTPVDFLTSFQMFNSTYKLYTHSYLGLGLKAARLAALGALNMEAAGQTFRSSCLPKQLEAEWHFGGIKYQYGGKKEGKTGFEPCYSEVLKVVQGKLHQPDEIQRSSFYAFSYYYDRAVDIDLIDYEKGGVLHVKDFERKAKQVCDNLDNYSSASPFLCMDLSYITALLKEGFGFGDSTILQLAKKVNNIETSWALGATFHLLQSLGLSH",
        "proteome": "UP000695026",
        "gene": "ENTPD5",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a977d00bde8672c76ffaaa6fe0b46fcc438a712c",
        "counters": {
            "domain_architectures": 20392,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20392
        }
    }
}