HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9F2R2F2",
"id": "A0A9F2R2F2_PYTBI",
"source_organism": {
"taxId": "176946",
"scientificName": "Python bivittatus",
"fullName": "Python bivittatus (Burmese python)"
},
"name": "CCR4-NOT transcription complex subunit 4",
"description": [
"Has E3 ubiquitin ligase activity, promoting ubiquitination and degradation of target proteins. Involved in activation of the JAK/STAT pathway. Catalyzes ubiquitination of methylated RBM15. Plays a role in quality control of translation of mitochondrial outer membrane-localized mRNA. As part of the PINK1-regulated signaling, upon mitochondria damage, ubiquitinates ABCE1 and thereby recruits autophagy receptors to the mitochondrial outer membrane to initiate mitophagy"
],
"length": 639,
"sequence": "MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTNVVDKNKNKVTSLQSSIDKPSDSLSIGNCDNSQQISNSDTPSPPPGLSKSNSVIPISSSNHSARSPFEGAITESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPMAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQQEDDLGFDPFDITRKALADLIEKELSVQDQPSLSPTSLQNPSPHTTTAKGSGSGFLHPATPTNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQATRYPWMAFPRNNIMHLNHTANPSSNSNFLDLNLPPQHSTGLGGIPIAGIPASAGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPTQTPHSNPFSTQIPLHRASWNPYSPPSNPASFHSPPPGFQTAFRPPSKPPTDLLQSSALDRH",
"proteome": "UP000695026",
"gene": "CNOT4",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004842",
"name": "ubiquitin-protein transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030014",
"name": "CCR4-NOT complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b80063a825e18f76bedddaef7378af223444bbe2",
"counters": {
"domain_architectures": 4965,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 2,
"profile": 3,
"pfam": 2,
"smart": 1,
"panther": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4965
}
}
}