GET /api/protein/UniProt/A0A9F2KWB7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9F2KWB7",
"id": "A0A9F2KWB7_PYTBI",
"source_organism": {
"taxId": "176946",
"scientificName": "Python bivittatus",
"fullName": "Python bivittatus (Burmese python)"
},
"name": "Protein phosphatase 1 regulatory subunit 3C",
"description": [
"Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown"
],
"length": 315,
"sequence": "MIQVLDPRPLPSSIMPVDVAMRICLAHSPPVKSFLNPLDEYQRRNFVDRLKPLRSCLNVKHETEHQNSDWKRSAGRAKKRVVFADSKGLSLTAIHVFSEFQENPAWDLQFDLSDLEDITAGLKLHEEKNLILGFTQPSADYLDFRNHLQKNFVCLENCTLQESTVSGTVKVKNVSFEKKVRVRITYDSWKTYSDNDCIYMNNVYGDSDNDTFSFAIELPPAIPTEQKIEFCVYYQSGDHIFWDNNDGQNYKIVHAEWKSDGVQVAASPKKGCLTLKSSRKVHETECEQLGSPRISSSFYPEWQKWSMVETSSPYW",
"proteome": "UP000695026",
"gene": "PPP1R3C",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d981275ae9741ff9e2b4f6d1737f34c99be0e6e3",
"counters": {
"domain_architectures": 10605,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"pirsf": 2,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10605
}
}
}