HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9E7MA85",
"id": "A0A9E7MA85_9EURY",
"source_organism": {
"taxId": "2866384",
"scientificName": "Thermococcus argininiproducens",
"fullName": "Thermococcus argininiproducens"
},
"name": "FAD synthase",
"description": [
"Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme"
],
"length": 148,
"sequence": "MMEKKKIRVVTGGVFDILHVGHIHFLQHAKELGDELIVIVAHDKTVEERKGRMPINSMYERAEVLKALKMVDDVVIGEPDCISFELVKKLNPDIIALGPDQNFDINVLKEELKKNGINAEVIRIPYSYKSDIAKTSKIIQKIVEIFCE",
"proteome": "UP001056425",
"gene": "ribL",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003919",
"name": "FMN adenylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006747",
"name": "FAD biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046444",
"name": "FMN metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "67074276eca3dd0a1392f72a13e344b6dc27e68b",
"counters": {
"domain_architectures": 82434,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 82434
}
}
}