GET /api/protein/UniProt/A0A9E6PQE8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9E6PQE8",
"id": "A0A9E6PQE8_9PSED",
"source_organism": {
"taxId": "2745495",
"scientificName": "Pseudomonas vanderleydeniana",
"fullName": "Pseudomonas vanderleydeniana"
},
"name": "Chemotaxis protein methyltransferase",
"description": [
"Methylation of the membrane-bound methyl-accepting chemotaxis proteins (MCP) to form gamma-glutamyl methyl ester residues in MCP"
],
"length": 269,
"sequence": "MSEVASLDDREFDQFQAWLYRAAGINLSQGKKALVAGRLFKRLKHYELESYGEYFRLIMSDQHKSELQVALDLLTTNETYFFREPKHFDFLRQQVLPKAPPGRLFRVWSAASSSGEEPYSLAMTLAEGLATTPWEVVGSDISTQVLARARSGHYPMERAGTLPMPMLTKYCLKGIGRQDGTFLIDKALRNRVNFVQVNLNENLPDLGEFEVIFLRNVMIYFDQKTKRQVVARLLPRLKSGGYFIISHSESLHGVNDTLKLVAPSIYRKP",
"proteome": "UP000634530",
"gene": "HU752_015100",
"go_terms": [
{
"identifier": "GO:0008757",
"name": "S-adenosylmethionine-dependent methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "aafc249059cc1b51b40e8f05b4f72a20facc4808",
"counters": {
"domain_architectures": 19683,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 1,
"ssf": 2,
"smart": 1,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19683
}
}
}