General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9D3RTG6",
        "id": "A0A9D3RTG6_ANGAN",
        "source_organism": {
            "taxId": "7936",
            "scientificName": "Anguilla anguilla",
            "fullName": "Anguilla anguilla (European freshwater eel)"
        },
        "name": "Growth arrest and DNA damage-inducible protein GADD45 gamma",
        "description": [
            "Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK"
        ],
        "length": 159,
        "sequence": "MTLEELRGQESTTEASDRMQCAGGALEELLVSAKKQDCLTVGVYESAKVMNVDPDSVAFCVLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADILGSEESGEPKDAHCILVTSSEDDSWKGSALEKLSVFCEESRSVYEWVPAITLPER",
        "proteome": "UP001044222",
        "gene": "ANANG_G00198100",
        "go_terms": [
            {
                "identifier": "GO:0051726",
                "name": "regulation of cell cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e648c895252343045e836caf4ce7bf2296aeba99",
        "counters": {
            "domain_architectures": 43462,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 43462
        }
    }
}