GET /api/protein/UniProt/A0A9D3RTG6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9D3RTG6",
"id": "A0A9D3RTG6_ANGAN",
"source_organism": {
"taxId": "7936",
"scientificName": "Anguilla anguilla",
"fullName": "Anguilla anguilla (European freshwater eel)"
},
"name": "Growth arrest and DNA damage-inducible protein GADD45 gamma",
"description": [
"Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK"
],
"length": 159,
"sequence": "MTLEELRGQESTTEASDRMQCAGGALEELLVSAKKQDCLTVGVYESAKVMNVDPDSVAFCVLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADILGSEESGEPKDAHCILVTSSEDDSWKGSALEKLSVFCEESRSVYEWVPAITLPER",
"proteome": "UP001044222",
"gene": "ANANG_G00198100",
"go_terms": [
{
"identifier": "GO:0051726",
"name": "regulation of cell cycle",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e648c895252343045e836caf4ce7bf2296aeba99",
"counters": {
"domain_architectures": 43462,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 43462
}
}
}