HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9D2MCL5",
"id": "A0A9D2MCL5_9FIRM",
"source_organism": {
"taxId": "2838578",
"scientificName": "Candidatus Faecalibacterium faecipullorum",
"fullName": "Candidatus Faecalibacterium faecipullorum"
},
"name": "Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit",
"description": [
"Responsible for channeling the electrons from the oxidation of dihydroorotate from the FMN redox center in the PyrD type B subunit to the ultimate electron acceptor NAD(+)"
],
"length": 259,
"sequence": "MRAACCDAAVLGQSAAASDIRLLRVRWPDPGHAPHAGQFFTLRAWAAGEAPFLSRPISVHKWEPETLTVTFLYQIVGEGTEKLSRLKEGDAVQLTGPMGNGFDAPALAARYEKIALVGGGIGTAPLYQLARELKACGRTPDVFFGFRDEPYCMEQYRGLAGIVKVSTDSGRVGFHGFVTQLYDPADYDVVLICGPTPMMRNAARLCAEKGTPCLVSLEKKMACGIGACLGCTIETASGAKSVCKDGPVFAGKEVFGWQT",
"proteome": null,
"gene": "pyrK",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051537",
"name": "2 iron, 2 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006221",
"name": "pyrimidine nucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0ca1e7c04292f2a7f5418ed31526f74f3e1bd24e",
"counters": {
"domain_architectures": 4802,
"entries": 20,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 3,
"ssf": 2,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4802
}
}
}