HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9C6WW00",
"id": "A0A9C6WW00_FRAOC",
"source_organism": {
"taxId": "133901",
"scientificName": "Frankliniella occidentalis",
"fullName": "Frankliniella occidentalis (Western flower thrips)"
},
"name": "Diphosphomevalonate decarboxylase",
"description": [
"Catalyzes the ATP dependent decarboxylation of (R)-5-diphosphomevalonate to form isopentenyl diphosphate (IPP). Functions in the mevalonate (MVA) pathway leading to isopentenyl diphosphate (IPP), a key precursor for the biosynthesis of isoprenoids and sterol synthesis"
],
"length": 350,
"sequence": "MHAKTTIMASPNFTKNCMWLNGKEESFGGNARLLSCLKEIQKRAQEDGTSKEILKWNIHVCSENNFPTAAGLASSAAGYACFVYALAKLYKVKGDVSQIARQGSGSACRSLEGGFVRWHMGNASNGSDSLATQVVPASHWPEMHVIILVVNDKKKKVSSTSGMQRSVETSELLKHRVAHCVPQRIAAIEKAIHNRDFPTFAEITMKDSNQFHAVALDTYPPAVYMNDVSHAIVDLIHCFNQVKGCTKVAYTFDAGPNACLYLLESAVAETMALVDYFFPSNNSGNTVQGLPVPPCNAKETVQAIEAVGMQKQDDGLLKYVIHTRIGEGAKELTDSGTHLLSASGLPLRLA",
"proteome": "UP000504606",
"gene": "LOC113205801",
"go_terms": [
{
"identifier": "GO:0004163",
"name": "diphosphomevalonate decarboxylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019287",
"name": "isopentenyl diphosphate biosynthetic process, mevalonate pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005829",
"name": "cytosol",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016831",
"name": "carboxy-lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008299",
"name": "isoprenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0c26d350e87e1863f06d8f8e4c843129e49d6074",
"counters": {
"domain_architectures": 8415,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 2,
"ssf": 2,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8415
}
}
}