GET /api/protein/UniProt/A0A9C6TTV4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9C6TTV4",
        "id": "A0A9C6TTV4_FRAOC",
        "source_organism": {
            "taxId": "133901",
            "scientificName": "Frankliniella occidentalis",
            "fullName": "Frankliniella occidentalis (Western flower thrips)"
        },
        "name": "Guanine nucleotide-binding protein subunit gamma",
        "description": [
            "Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction"
        ],
        "length": 72,
        "sequence": "MDPSTLAAMDKDALKKQIENMKYQATMERWPLSRSIAAMREFVEENEKSDPLIHAPDKKNNPWAEKGKCSIM",
        "proteome": "UP000504606",
        "gene": "LOC113217240",
        "go_terms": [
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031681",
                "name": "G-protein beta-subunit binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007200",
                "name": "phospholipase C-activating G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050909",
                "name": "sensory perception of taste",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005834",
                "name": "heterotrimeric G-protein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a9480ece7c587f54416519bfe41f3d087d848e1",
        "counters": {
            "domain_architectures": 13729,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 2,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13729
        }
    }
}