GET /api/protein/UniProt/A0A9B0WXZ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9B0WXZ2",
"id": "A0A9B0WXZ2_CHRAS",
"source_organism": {
"taxId": "185453",
"scientificName": "Chrysochloris asiatica",
"fullName": "Chrysochloris asiatica (Cape golden mole)"
},
"name": "Translin-associated protein X",
"description": [
"Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis"
],
"length": 291,
"sequence": "MSNKEGPGGFRKRKHDTFPHNPRREGKDVHSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDREEVLTESEVKLDSVRQKILQVAQELAGEDMHQFHRAITIGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDTGKENKTPSSDVQDKQQLGTWSLKVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS",
"proteome": "UP000504623",
"gene": "TSNAX",
"go_terms": [
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "609b1432c372911cb78c464d2d7b7252a4536b5f",
"counters": {
"domain_architectures": 7976,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7976
}
}
}