GET /api/protein/UniProt/A0A9B0WQM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9B0WQM3",
"id": "A0A9B0WQM3_CHRAS",
"source_organism": {
"taxId": "185453",
"scientificName": "Chrysochloris asiatica",
"fullName": "Chrysochloris asiatica (Cape golden mole)"
},
"name": "Mediator of RNA polymerase II transcription subunit 11",
"description": [
"Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors"
],
"length": 117,
"sequence": "MATYSLANERLRALEDIEREIGAILQNAGNVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLNDVAHTCEQMLEN",
"proteome": "UP000504623",
"gene": "MED11",
"go_terms": [
{
"identifier": "GO:0003712",
"name": "transcription coregulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006357",
"name": "regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016592",
"name": "mediator complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "79dcc9b4a3c96f63e681f2637d4ec429355fef04",
"counters": {
"domain_architectures": 3298,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3298
}
}
}