General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9B0WKG6",
        "id": "A0A9B0WKG6_CHRAS",
        "source_organism": {
            "taxId": "185453",
            "scientificName": "Chrysochloris asiatica",
            "fullName": "Chrysochloris asiatica (Cape golden mole)"
        },
        "name": "Meiotic recombination protein SPO11",
        "description": [
            "Component of a topoisomerase 6 complex specifically required for meiotic recombination. Together with TOP6BL, mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. The complex promotes relaxation of negative and positive supercoiled DNA and DNA decatenation through cleavage and ligation cycles. Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2"
        ],
        "length": 396,
        "sequence": "MAFAPMGPEASFFEVLEQHRASLLAALRTGREESPRGGTRSISNSEVLASIENIIQDIITSLARNEAPVFTIENRSRWENMKFEDSVGLQMVSHCTTRKVKSDSPKSAQNFALILKILSMIYKLVQSDTYATKRDIYYTDCQLFGNQTVVDNIINDISCMLKVPRRSLHILSTSKGLIAGNLSYLEEDGTRVSCAGCSTAVAVPSNIQGLRNLITDAKFLLIVEKDATFQRLLDDNFCSKMSPCIMVTGKGVPDLNTRLFVKKLWELFHIPLFTLVDADPHGIEIMCIYKYGSMSMSFEAHNLTVPAIRWLGLLPSDIKRLNIPKNTLIPLTNRDQMKLDSILKRPYVAGQPFWRKEMEIMADTKMKAEIQALTYIASDYLSRVYLPNKLKFGGWI",
        "proteome": "UP000504623",
        "gene": "SPO11",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005694",
                "name": "chromosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006259",
                "name": "DNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007131",
                "name": "reciprocal meiotic recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003918",
                "name": "DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042138",
                "name": "meiotic DNA double-strand break formation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fea0fae0882d1668b8b1d3e8485152076aacb848",
        "counters": {
            "domain_architectures": 279,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 1,
                "pfam": 3,
                "cdd": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 279
        }
    }
}