GET /api/protein/UniProt/A0A977KWZ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A977KWZ3",
        "id": "A0A977KWZ3_9CYAN",
        "source_organism": {
            "taxId": "2824559",
            "scientificName": "Woronichinia naegeliana WA131",
            "fullName": "Woronichinia naegeliana WA131"
        },
        "name": "Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase",
        "description": [
            "Catalyzes the formation of the isocyclic ring in chlorophyll biosynthesis. Mediates the cyclase reaction, which results in the formation of divinylprotochlorophyllide (Pchlide) characteristic of all chlorophylls from magnesium-protoporphyrin IX 13-monomethyl ester (MgPMME)"
        ],
        "length": 387,
        "sequence": "MVTTLQKPEYDEIRQGVKVPAKETILTPRFYTTDFDAMAKMDISINEDELDAIIQEFRVDYNRHHFVRDEQFQQSWDHIDGKTRSLFIEFLERSCTAEFSGFLLYKELSRKLKDINPVLAEGFQLMSRDEARHAGFLNKAMTDFDLSLDLGFLTRSRSYTYFEPEFIFYATYLSEKIGYWRYITIYRHLEAHPEDRVYPIFNFFENWCQDENRHGDFFDAVMRAKPQMLDQPQTWWQKLTAFPRSFSQKAWSRYLMVTLVSPVLWCRFFLLSVFATMYLNDTQRADFYASIGLEARQYDKEVIAKTNETAGRVFPVILDVDHPEFYARLETCVSNNEKLRAIDASNQPTWLKGLQKFPIFLSNGWQFLKLYWIKPIPSEELARSFGF",
        "proteome": null,
        "gene": "acsF",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048529",
                "name": "magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015995",
                "name": "chlorophyll biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c28d9dd5f2ef3f69dfceefe596ca7e2073bbd46",
        "counters": {
            "domain_architectures": 9803,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9803
        }
    }
}