HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A977KWZ3",
"id": "A0A977KWZ3_9CYAN",
"source_organism": {
"taxId": "2824559",
"scientificName": "Woronichinia naegeliana WA131",
"fullName": "Woronichinia naegeliana WA131"
},
"name": "Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase",
"description": [
"Catalyzes the formation of the isocyclic ring in chlorophyll biosynthesis. Mediates the cyclase reaction, which results in the formation of divinylprotochlorophyllide (Pchlide) characteristic of all chlorophylls from magnesium-protoporphyrin IX 13-monomethyl ester (MgPMME)"
],
"length": 387,
"sequence": "MVTTLQKPEYDEIRQGVKVPAKETILTPRFYTTDFDAMAKMDISINEDELDAIIQEFRVDYNRHHFVRDEQFQQSWDHIDGKTRSLFIEFLERSCTAEFSGFLLYKELSRKLKDINPVLAEGFQLMSRDEARHAGFLNKAMTDFDLSLDLGFLTRSRSYTYFEPEFIFYATYLSEKIGYWRYITIYRHLEAHPEDRVYPIFNFFENWCQDENRHGDFFDAVMRAKPQMLDQPQTWWQKLTAFPRSFSQKAWSRYLMVTLVSPVLWCRFFLLSVFATMYLNDTQRADFYASIGLEARQYDKEVIAKTNETAGRVFPVILDVDHPEFYARLETCVSNNEKLRAIDASNQPTWLKGLQKFPIFLSNGWQFLKLYWIKPIPSEELARSFGF",
"proteome": null,
"gene": "acsF",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0048529",
"name": "magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015979",
"name": "photosynthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015995",
"name": "chlorophyll biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3c28d9dd5f2ef3f69dfceefe596ca7e2073bbd46",
"counters": {
"domain_architectures": 9803,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9803
}
}
}