General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A975S676",
        "id": "A0A975S676_9MICC",
        "source_organism": {
            "taxId": "2816859",
            "scientificName": "Arthrobacter sunyaminii",
            "fullName": "Arthrobacter sunyaminii"
        },
        "name": "2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase",
        "description": [
            "Catalyzes the non-heme iron(II)-dependent oxidative cleavage of 2,3-dihydroxyphenylpropionic acid and 2,3-dihydroxicinnamic acid into 2-hydroxy-6-ketononadienedioate and 2-hydroxy-6-ketononatrienedioate, respectively"
        ],
        "length": 313,
        "sequence": "MKQALVCMSHSPLLEHTDPPAEVKAAVEAAFDQVRAFAAEFKPDLIVNFGPDHYNGFFYDLMPPFCIGYEAHGTGDYDSWDGPLNVPTDIAHELAQYVIDQDIETAISRKMEVDHGAVQPMEIIYGDLSEVPVIPVFINSVAPPFSKMSRIREFGTAVGNYFKNSDKKVLFIGSGGLSHDPPVPQIATATEEQRAFLTDGRHPTPEARAARQQRTIDTAKAFARGEADIMDLNPEWDRAFLDVCRSGDVSRFDAYVPAEMDAVAGHSSHEVRTWVAAYSALRACGEYEVTYEFYKPIKEYIAGFGVTTAVLVP",
        "proteome": "UP000680588",
        "gene": "mhpB",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0047070",
                "name": "3-carboxyethylcatechol 2,3-dioxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008198",
                "name": "ferrous iron binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ce6980a9d05405990e19341db4d65af1eb11bff8",
        "counters": {
            "domain_architectures": 25975,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25975
        }
    }
}