GET /api/protein/UniProt/A0A974SFE4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974SFE4",
"id": "A0A974SFE4_9BACL",
"source_organism": {
"taxId": "373687",
"scientificName": "Paenibacillus sonchi",
"fullName": "Paenibacillus sonchi"
},
"name": "Quinol oxidase subunit 4",
"description": [
"Catalyzes quinol oxidation with the concomitant reduction of oxygen to water"
],
"length": 97,
"sequence": "MMKQLFPIRHVMGYLASLVLSAAALIVIYGDLSKGANMAVLLVTAIIQASLQLFVFMHIGESADTKKELYINIAYALFVGLVTIYGTLYIFVWGWYA",
"proteome": "UP000595841",
"gene": "qoxD",
"go_terms": [
{
"identifier": "GO:0016682",
"name": "oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042773",
"name": "ATP synthesis coupled electron transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "de13d8abe9b9784468cf40215f1cab89797045c7",
"counters": {
"domain_architectures": 15179,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15179
}
}
}