General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974QNW7",
        "id": "A0A974QNW7_STAHO",
        "source_organism": {
            "taxId": "1290",
            "scientificName": "Staphylococcus hominis",
            "fullName": "Staphylococcus hominis"
        },
        "name": "Copper chaperone CopZ",
        "description": [
            "Chaperone that serves for the intracellular sequestration and transport of Cu(+). Delivers Cu(+) to the copper-exporting P-type ATPase A (CopA)"
        ],
        "length": 69,
        "sequence": "MINKVIKVDGMSCDHCKNTIESALAKINGVRTAEVDLDKNEVRVDYNDELVSTKDLHDTIEDQGYDVKE",
        "proteome": null,
        "gene": "BUZ51_02810",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005507",
                "name": "copper ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006825",
                "name": "copper ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "91d90ceccec4f7a952bc67ca1a5ca741c2b91ba0",
        "counters": {
            "domain_architectures": 59696,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 59696
        }
    }
}