General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974NK13",
        "id": "A0A974NK13_PERPY",
        "source_organism": {
            "taxId": "1407",
            "scientificName": "Peribacillus psychrosaccharolyticus",
            "fullName": "Peribacillus psychrosaccharolyticus"
        },
        "name": "Coproheme decarboxylase",
        "description": [
            "Involved in coproporphyrin-dependent heme b biosynthesis. Catalyzes the decarboxylation of Fe-coproporphyrin III (coproheme) to heme b (protoheme IX), the last step of the pathway. The reaction occurs in a stepwise manner with a three-propionate intermediate"
        ],
        "length": 247,
        "sequence": "MSQAAQTLDGWYCLHDFRLIDWTSWKLLSSDERQTALAEFQGLMEKWNAVQDQKTGSHATYSIVGQKADFMMMFVRPTMEELNEIEMEFNKSKLAEYTIPAYSYVSVVELSNYLPSEEDPYQNEHVRSRLYPILPKASHICFYPMDKKREGNDNWYMLPMDERKSLMRSHGLIGRSYAGKVKQIISGSVGFDDYEWGVTLFADDVLQFKKLIYEMRFDEVSARYADFGTFFVGNILPEENFQAFFTV",
        "proteome": "UP000595254",
        "gene": "chdC",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004601",
                "name": "peroxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d2c0865503250450ac0d878571e412e857262b1",
        "counters": {
            "domain_architectures": 7224,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7224
        }
    }
}