GET /api/protein/UniProt/A0A974HQS5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974HQS5",
        "id": "A0A974HQS5_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Creatine kinase U-type, mitochondrial",
        "description": [
            "Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa"
        ],
        "length": 418,
        "sequence": "MASTFSRILSSRKSAGLLAMVGAGSVATGYLMTRDAISADTSHKRRMYPASAEYPDLRKHNNCMASSLTPAIYTKLCDKTTPAGFTLDECIQTGVDNPGHPFIKTVGMVAGDEECYEVFGDLFDPVIKERHNGYDPHTMKHPTDLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVSVDALSGLKGDLSGQYYSLTQMTDKEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRIISMEKGGNMKRVFERFCRGLKEVEKLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHVNLPLLSKDARFSKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELVQMVIDGVNYLIDCEKRLERKQDIRVPAPLSQFKH",
        "proteome": null,
        "gene": "XELAEV_18020560mg",
        "go_terms": [
            {
                "identifier": "GO:0016301",
                "name": "kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016772",
                "name": "transferase activity, transferring phosphorus-containing groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016775",
                "name": "phosphotransferase activity, nitrogenous group as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046314",
                "name": "phosphocreatine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6b2eaec91909209d662bde7a13aa25c4c5ed3fae",
        "counters": {
            "domain_architectures": 9052,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9052
        }
    }
}