HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974HKR7",
"id": "A0A974HKR7_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Squalene synthase",
"description": [
"Catalyzes the condensation of 2 farnesyl pyrophosphate (FPP) moieties to form squalene. Proceeds in two distinct steps. In the first half-reaction, two molecules of FPP react to form the stable presqualene diphosphate intermediate (PSQPP), with concomitant release of a proton and a molecule of inorganic diphosphate. In the second half-reaction, PSQPP undergoes heterolysis, isomerization, and reduction with NADPH or NADH to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway"
],
"length": 467,
"sequence": "MASVNCKTAVSLFKRTLSLGPAQKPCGQRSLLTASRLQERGLKEGRTVQICFAPQSQAVCRIHPVYFLQQDSMSDSLQTCYRYLNETSRSFAAVIQALDGELRHAVCIFYLVLRALDTVEDDMTIALETKIPMLHDFHTYLYQADWRYMGSKEKDKQVLEDFPTISLEFRKLEAIYQEVIADICHKMGVGMSEYLEKKVETLQEWDQYCHYVAGLVGIGLSRLFSASELEDPIVGLDTKLSNSMGLFLQKTNIIRDYLEDQMEGREFWPKEVWGKYGKKLSDLANPEQIVPAVHCMNELITNALHHVPDVLTYLSRLKNQSVFNFCSIPQVMAIATLAACYNNQQVFKGVVKIRKGQAVTLMMDATNIEAVRAIMYQYVEEIYQKIPLTDPSSGRTQHIVTSVRNLSLSDASLASRNHFSPIYLSCVWCKHKGNVQPPRCTLFTQRIMGLNQSDPSDGNFGSRLGKT",
"proteome": null,
"gene": "XELAEV_18028228mg",
"go_terms": [
{
"identifier": "GO:0051996",
"name": "squalene synthase [NAD(P)H] activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045338",
"name": "farnesyl diphosphate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008610",
"name": "lipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016765",
"name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7ee50707bedad879bc606a96fc69cbee4c35c950",
"counters": {
"domain_architectures": 33932,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"sfld": 2,
"panther": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33932
}
}
}