GET /api/protein/UniProt/A0A974H734/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974H734",
        "id": "A0A974H734_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Rho-related GTP-binding protein RhoG",
        "description": [
            "Plays a role in immunological synaptic F-actin density and architecture organization. Regulates actin reorganization in lymphocytes, possibly through the modulation of Rac1 activity. Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. Binds phospholipids in an activation-dependent manner; thereby acting as an anchor for other proteins to the plasma membrane (PM). Plays a role in exocytosis of cytotoxic granules (CG) by lymphocytes/Component of the exocytosis machinery in natural killer (NK) and CD8+ T cells. Promotes the docking of cytotoxic granules (CG) to the plasma membrane through the interaction with UNC13D. Involved in the cytotoxic activity of lymphocytes/primary CD8+ T cells"
        ],
        "length": 191,
        "sequence": "MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQMTVDGRTVSLNLWDTAGQEEYDRLRTLSYPQTNVFIICFSIGSPSSYANVRHKWHPEVSHHCPNVPILLVGTKQDLRNDTETIKKLKEQSLAPTTNQQGSSLAKQIGAVKYMECSALHQQGVRQVFEEAVRAVLYPVTKKNPKKCILL",
        "proteome": null,
        "gene": "rhog2.L",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007264",
                "name": "small GTPase-mediated signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
        "counters": {
            "domain_architectures": 273930,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 1,
                "profile": 3,
                "smart": 4,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 273930
        }
    }
}