GET /api/protein/UniProt/A0A974H3T6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974H3T6",
        "id": "A0A974H3T6_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "tRNA wybutosine-synthesizing protein 5",
        "description": [
            "tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes"
        ],
        "length": 317,
        "sequence": "MEIKQQKISLPEYTNVDRQTFLQDIYPLRKPVVLKGLHLGDCSTKWTVDYMSKTGGSKEVKIHVSEVPQMDFIRKNFLYRTLPFDTFVKRAAKEKHTEFFISENEKYYLRSLGEDPRKDIADISKQFPQLATDIHVPEFFEKDQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLYSPRDAPYLYLSGDKSEVLDVDNPDLVKYPLFSHARRYECYLEAGDVLFIPALWFHNTVADGFGVGVNVFWKDLPSECYDKTDTYGNKDPCAASRAMQILDRALKTLEELPEEYKDFYARRMVLRIQAKAYSANYE",
        "proteome": null,
        "gene": "tyw5.L",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5d41e923a439c53f1b9a856f458a45c234c1cc30",
        "counters": {
            "domain_architectures": 25377,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25377
        }
    }
}