GET /api/protein/UniProt/A0A974H3T6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974H3T6",
"id": "A0A974H3T6_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "tRNA wybutosine-synthesizing protein 5",
"description": [
"tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes"
],
"length": 317,
"sequence": "MEIKQQKISLPEYTNVDRQTFLQDIYPLRKPVVLKGLHLGDCSTKWTVDYMSKTGGSKEVKIHVSEVPQMDFIRKNFLYRTLPFDTFVKRAAKEKHTEFFISENEKYYLRSLGEDPRKDIADISKQFPQLATDIHVPEFFEKDQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLYSPRDAPYLYLSGDKSEVLDVDNPDLVKYPLFSHARRYECYLEAGDVLFIPALWFHNTVADGFGVGVNVFWKDLPSECYDKTDTYGNKDPCAASRAMQILDRALKTLEELPEEYKDFYARRMVLRIQAKAYSANYE",
"proteome": null,
"gene": "tyw5.L",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5d41e923a439c53f1b9a856f458a45c234c1cc30",
"counters": {
"domain_architectures": 25377,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 25377
}
}
}