GET /api/protein/UniProt/A0A974DVV6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974DVV6",
        "id": "A0A974DVV6_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "MORN repeat-containing protein 3",
        "description": [
            "Assembles a suppression complex (suppresome) by tethering SIRT1 and MDM2 to regulate composite modifications of p53/TP53. Confers both deacetylation-mediated functional inactivation, by SIRT1, and ubiquitination-dependent degradation, by MDM2, of p53/TP53, promoting a proliferative and cell survival behaviors. May play a role in the regulation of spermatogenesis"
        ],
        "length": 238,
        "sequence": "MPLVKAPKKAEPIWKEWDAKAQKAGLRHSVYSVNGDEYTGEWLNNLRHGKGTYMWKRRKSIYEGDWKCGERSGFGTYSVQDSNTGEYIKVYSGYWDNDKKHGYGTHFYSAKEYYEGEWKCGKRCGWGRMYFANGDIYEGEWLEDKHSGQGMLCLANENRYEGSWKDGKKHGPGKFYYLNKGQLYEGVWVEDIPKCGTMVDFGRTEAPYPTKYPLPEVKVADPEGVLKEAQQPLFGEHE",
        "proteome": null,
        "gene": "morn3.S",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d27923c7e94b610296b23143bcd3bad806663de2",
        "counters": {
            "domain_architectures": 3263,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3263
        }
    }
}