GET /api/protein/UniProt/A0A974DS77/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974DS77",
"id": "A0A974DS77_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Sesquipedalian",
"description": [
"Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane"
],
"length": 259,
"sequence": "MEGSLLKWTNYLSGWKPRYFVLDSGILSYYDSPEDVGKVSKSSIKMAVCEIRVNPSDDSRMDLIIPNEQYFYLRTENAAERQKWLVALGSAKACLGDSATQRPKEETSASETLGRKLSELRVYCSYLMQQIKEMQGAVDPDGPGASPDIEKARAACCALYGACSHISSSLEDCMRHISTKQDGIAQEMPPPETPAAIELPQAQKVKNSVTTSPMRTPQSVYEAPRQIDDVTVLWKLEDMARWSRKRSKEVVLLNRNTAG",
"proteome": null,
"gene": "XB5957062.L",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dd69e240ae962412f2508541cd6bc19e1b0a4e5d",
"counters": {
"domain_architectures": 45728,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"profile": 1,
"smart": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 45728
}
}
}