GET /api/protein/UniProt/A0A974DQ91/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974DQ91",
        "id": "A0A974DQ91_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "P2X purinoceptor",
        "description": [
            "ATP-gated nonselective transmembrane cation channel permeable to potassium, sodium and with relatively high calcium permeability. Furthermore, CTP functions as a weak affinity agonist for P2RX1",
            "Receptor for ATP that acts as a ligand-gated ion channel"
        ],
        "length": 412,
        "sequence": "MGLKMKEKVSNFLFEYDTPRMVLVRDKKVGLTFRMIQVGVLAYIIGWVFVYEKGYQNVDGIISSVSVKIKGLAVTDLPGVGTEIWDAVDYVFPPQGDSSFVVMTNFITTADQKMGYCNELPDVAPCETNDDCKITAFRQSQGVMTGNCTTYDNKTKSCQIYAWCPVENDYTVPKPPLLSQAENFTLFIKNSISFPRHEVTRQNLVESVTSSYLKKCIYHKETDPLCPVFRLGYIVEQSGRNFSELAYKGGTISIVIDWQCDLDWPVRYCKPIYEFHGLQDENKVSQGFNFRHARYYKEDGVSKRTLFKVFGIRFDILVNGQGGKFDIIPTMTTIGSGIGIFGVATVVCDLMLLHVLPKRNYYKEKKFKQAKTDQKDSQEKVEVYTYSQNGQQLNSSSSENVYDTQLNTYNSC",
        "proteome": null,
        "gene": "p2rx1.L",
        "go_terms": [
            {
                "identifier": "GO:0001614",
                "name": "purinergic nucleotide receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004931",
                "name": "extracellularly ATP-gated monoatomic cation channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033198",
                "name": "response to ATP",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0098655",
                "name": "monoatomic cation transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005216",
                "name": "monoatomic ion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006811",
                "name": "monoatomic ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "075c52d56606cff53863a3b664040458a3060d59",
        "counters": {
            "domain_architectures": 7718,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7718
        }
    }
}