HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974DQ91",
"id": "A0A974DQ91_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "P2X purinoceptor",
"description": [
"ATP-gated nonselective transmembrane cation channel permeable to potassium, sodium and with relatively high calcium permeability. Furthermore, CTP functions as a weak affinity agonist for P2RX1",
"Receptor for ATP that acts as a ligand-gated ion channel"
],
"length": 412,
"sequence": "MGLKMKEKVSNFLFEYDTPRMVLVRDKKVGLTFRMIQVGVLAYIIGWVFVYEKGYQNVDGIISSVSVKIKGLAVTDLPGVGTEIWDAVDYVFPPQGDSSFVVMTNFITTADQKMGYCNELPDVAPCETNDDCKITAFRQSQGVMTGNCTTYDNKTKSCQIYAWCPVENDYTVPKPPLLSQAENFTLFIKNSISFPRHEVTRQNLVESVTSSYLKKCIYHKETDPLCPVFRLGYIVEQSGRNFSELAYKGGTISIVIDWQCDLDWPVRYCKPIYEFHGLQDENKVSQGFNFRHARYYKEDGVSKRTLFKVFGIRFDILVNGQGGKFDIIPTMTTIGSGIGIFGVATVVCDLMLLHVLPKRNYYKEKKFKQAKTDQKDSQEKVEVYTYSQNGQQLNSSSSENVYDTQLNTYNSC",
"proteome": null,
"gene": "p2rx1.L",
"go_terms": [
{
"identifier": "GO:0001614",
"name": "purinergic nucleotide receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004931",
"name": "extracellularly ATP-gated monoatomic cation channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033198",
"name": "response to ATP",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0098655",
"name": "monoatomic cation transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005216",
"name": "monoatomic ion channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006811",
"name": "monoatomic ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "075c52d56606cff53863a3b664040458a3060d59",
"counters": {
"domain_architectures": 7718,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"prints": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7718
}
}
}