GET /api/protein/UniProt/A0A974CYM9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974CYM9",
        "id": "A0A974CYM9_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "HMG box domain-containing protein",
        "description": [
            "Transcription factor that modulates cell fate reprogramming from the somatic state to the pluripotent and neuronal fate. Also acts as a regulatory component of protein phosphatase 1 (PP1) complexes. Component of the PNUTS-PP1 protein phosphatase complex, a PP1 complex that regulates RNA polymerase II transcription pause-release. PNUTS-PP1 also plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase"
        ],
        "length": 576,
        "sequence": "MDVRFYPAAAGNALSGDPSNLDFTQCLDYYSYKFGNNNYMNMTEANNAFLAANETFHTPSLGDEEFEIPPITPPPETDPALAMTDVLLPFQVLGEALAAQGNGFTPQFPPQSLDLPSITISRNLMEQEGVLHNNGLSLDQHQAQMSQYRQDHSLIMRSLAHMTDAVRAGIMPPSQLTTINQSQLSAQLGLNIGSTAIPHTSPSPPASKSATPSPSSSVNDEDVDETNRIIGEKRGAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLSSTLLLNTSLSQHAAMSMESQNLQQSIPRAIAPKPLTMRLPLNQIVTSVTIAQNMQSKIGTPLMSSVGAPMVATHPSQVSPTLQSQQHQIQQLQQQQQLHQMQQQQLHEHQMHQQIQQQMQQQQFQQHMQQQLQQQQQQQLQQQMQQQLQHIHLQHMQQQQMQHIQHQSQLSPQQQSPAGSQSGVPAQIASPIPHINSPSPASQHHQHPQAQTQLLSQVSIF",
        "proteome": null,
        "gene": "XELAEV_18024769mg",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba71805ac3750d134530e8b8d14e816f9d4dbece",
        "counters": {
            "domain_architectures": 54587,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 54587
        }
    }
}