GET /api/protein/UniProt/A0A974C2G0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974C2G0",
"id": "A0A974C2G0_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Notch-regulated ankyrin repeat-containing protein",
"description": [
"Promotes loss of intracellular domain (ICD) of Notch1 in embryos. By down-regulating ICD levels, could function as a negative feedback regulator of Notch signaling that attenuates ICD-mediated transcription. Involved in angiogenesis. May be involved in somitogenesis"
],
"length": 114,
"sequence": "MSQAEMSTCSMPHTQRVFQEAVRNGNTKELHSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAYGGHQDIVLYLITKAKYSSSSR",
"proteome": "UP000186698",
"gene": "nrarp.L",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6a2b245675e56d7c902b06d6a34c0b06f035c112",
"counters": {
"domain_architectures": 107062,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"profile": 2,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 107062
}
}
}