GET /api/protein/UniProt/A0A921QP13/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A921QP13",
"id": "A0A921QP13_SORBI",
"source_organism": {
"taxId": "4558",
"scientificName": "Sorghum bicolor",
"fullName": "Sorghum bicolor (Sorghum)"
},
"name": "t-SNARE coiled-coil homology domain-containing protein",
"description": [
"Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles"
],
"length": 122,
"sequence": "MNSRRDFRSHRAALFDGIEEGGVRAPAYSSREIHEHENDQAMDSLHDRVSILKRLTGDIHEEVENHNRMLDRMGNDMDASRGFLSGTVDKFKMVFETKSSRRMATMVASFIAVFLLIYYLTK",
"proteome": null,
"gene": "BDA96_07G176800",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1
}
}
}