HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A921MY84",
"id": "A0A921MY84_9FIRM",
"source_organism": {
"taxId": "1776391",
"scientificName": "Romboutsia timonensis",
"fullName": "Romboutsia timonensis"
},
"name": "Aspartokinase",
"description": [
"Catalyzes the phosphorylation of the beta-carboxyl group of aspartic acid with ATP to yield 4-phospho-L-aspartate, which is involved in the branched biosynthetic pathway leading to the biosynthesis of amino acids threonine, isoleucine and methionine"
],
"length": 399,
"sequence": "MSTIIHKYGGTSIGSIEKIKSVAKKIILEKEKGNDVVVVVSAMGKTTNKLVDLAKEISSNPDKREFDVLLSTGEQISISLLAIAIKSLGYDAISFTGYQVGIKTKGIHTKSEIDDIDTDRIKENLEQGKIVIIAGFQGINEDGDITTLGRGGSDTTAVSLAAALGCKCIIYTDVEGIYPVDPKFYPNAKKLDYISYKEMIEMARLGAGVMETTSVETGYRKNVLIYVTSSSKDTKGTYITENKNTINYKPITGIAIDDNTSILTIKNILSKSNDTSTILEILSNNNLEIKMINEVASDDEYSNLSFIVSKGDLGCVDKAMEEIKLKINCVEVCKDLDVSTISVVSKDINYNVINKIFNILKKDNIEFKQVFTSELSISFIVDNKYKQRFIELLGSEFNL",
"proteome": null,
"gene": "K8V90_00030",
"go_terms": [
{
"identifier": "GO:0004072",
"name": "aspartate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008652",
"name": "amino acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b73790bda6cd15191430dc28c4ec048bb434309a",
"counters": {
"domain_architectures": 77738,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 2,
"pirsf": 1,
"ncbifam": 3,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 77738
}
}
}