GET /api/protein/UniProt/A0A915HPY0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A915HPY0",
        "id": "A0A915HPY0_ROMCU",
        "source_organism": {
            "taxId": "13658",
            "scientificName": "Romanomermis culicivorax",
            "fullName": "Romanomermis culicivorax (Nematode worm)"
        },
        "name": "Methionine aminopeptidase 2",
        "description": [
            "Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val)"
        ],
        "length": 381,
        "sequence": "MPPKNKGAKKDNAGKKSAATNDTKVDDDLLDALINEVNSKTAVHEQPPPPDMPSVPIDKQFCAADYPVGQILEYPAVQDGTTAVNRITNEEKKALDSSYLEIYQDFRRAAEAHRQNRKWVKSWIKPGMTMIDICERLESCSRKLINEDELKAGLAFPTGCSLNHVAAHYTPNAGDPTVLQYDDVCKIDFGLHVNGRIIDCAFTVHFNPKYDKLVEAVKDATNTGIKTAGIDVRLCDVGEAIEEVMTSYEVDLDGKTYRVKPIRNLNGHSIGPYRIHAGKTVPIVKGGEETKMEENEFYAIETFGSTGKGYVHDDMECSHYMKDYYAGHVPLRLKSSKMLLNTINKHFGTLAFCRRWLDRLGETKYLMALKVRVSWVLKEER",
        "proteome": "UP000887565",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0070006",
                "name": "metalloaminopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b3f357c661ba295d4df0c6b55962d5d621766ffe",
        "counters": {
            "domain_architectures": 70904,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 1,
                "pfam": 1,
                "cathgene3d": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 70904
        }
    }
}