GET /api/protein/UniProt/A0A8X8GFD0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8X8GFD0",
        "id": "A0A8X8GFD0_ACIFI",
        "source_organism": {
            "taxId": "1232575",
            "scientificName": "Acidithiobacillus ferridurans",
            "fullName": "Acidithiobacillus ferridurans"
        },
        "name": "Ribulose bisphosphate carboxylase small subunit",
        "description": [
            "RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site. Although the small subunit is not catalytic it is essential for maximal activity"
        ],
        "length": 118,
        "sequence": "MSEVQDYQSRLSDPASRKFETLSYLPALTAEQIRQQVAYIVSKGWNPAVEHTEPENAFGNYWYMWKLPMFGETDVDTILKEAEACHKANPHNHVRIVGYDNFKQSQGTSLVVYRGKTV",
        "proteome": null,
        "gene": "cbbS",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "322f51fb3c3504dedc16381c256895b71eb3ba3e",
        "counters": {
            "domain_architectures": 4494,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4494
        }
    }
}