GET /api/protein/UniProt/A0A8U1H673/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8U1H673",
"id": "A0A8U1H673_SALNM",
"source_organism": {
"taxId": "8040",
"scientificName": "Salvelinus namaycush",
"fullName": "Salvelinus namaycush (Lake trout)"
},
"name": "Rab-like protein 3",
"description": [
"Required for KRAS signaling regulation and modulation of cell proliferation. Regulator of KRAS prenylation, and probably prenylation of other small GTPases. Required for lymphocyte development and function. Not required for myeloid cell development"
],
"length": 231,
"sequence": "MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVHDYKEGTPEEKTYYIELWDVGGSVGSASSLKNTRAVFYNSVNGIVLVHDLTNKKSSQNLYRWSLEALNKDSSPTGVIVSNGDYDREQFADSSVPLLLIGTKFDQIPENKRNDVLTRTAFLSEDFNAEEINLDCTNQRYFAAGTSNAVKLSRFFDKVVEKRYFTRDPSQMTGFTERKRFNFKSVHYD",
"proteome": "UP000808372",
"gene": "rabl3",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "86532a119911c6c2cee7c803261dbd942b50b61d",
"counters": {
"domain_architectures": 6717,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6717
}
}
}