GET /api/protein/UniProt/A0A8U0N5X4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8U0N5X4",
"id": "A0A8U0N5X4_MUSPF",
"source_organism": {
"taxId": "9669",
"scientificName": "Mustela putorius furo",
"fullName": "Mustela putorius furo (European domestic ferret)"
},
"name": "Solute carrier family 25 member 33",
"description": [
"Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. Selectively transports uridine, thymidine, guanosine, cytosine and inosine (deoxy)nucleoside di- and triphosphates by an antiport mechanism. May import (deoxy)nucleoside triphosphates in exchange for intramitochondrial (deoxy)nucleoside diphosphates, thus providing precursors necessary for de novo synthesis of mitochondrial DNA and RNA while exporting products of their catabolism. Participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential and mitochondrial respiration. Upon INS or IGF1 stimulation regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription, the ratio of mitochondria-to nuclear-encoded components of the electron transport chain resulting in control of mitochondrial ROS production. Participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation"
],
"length": 321,
"sequence": "MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGVVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNLVHILSAGSAAFVTNTLMNPIWMVKTRMQLERKVRGCKQTNTLQCARHVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLAASTNGTEKNSTSFFGLMAAAAISKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ",
"proteome": "UP000000715",
"gene": "SLC25A33",
"go_terms": [
{
"identifier": "GO:0015218",
"name": "pyrimidine nucleotide transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}