General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8U0MQY7",
        "id": "A0A8U0MQY7_MUSPF",
        "source_organism": {
            "taxId": "9669",
            "scientificName": "Mustela putorius furo",
            "fullName": "Mustela putorius furo (European domestic ferret)"
        },
        "name": "Arginyl-tRNA--protein transferase 1",
        "description": [
            "Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein. This arginylation is required for degradation of the protein via the ubiquitin pathway"
        ],
        "length": 598,
        "sequence": "MQRAGPNSGPGGRNTTLAKVSAGAGTRRDRSPEEAVEARVGELGRTRQASVLLPSPPRAPALRRGWPQGAERRGRPWRTLEAAMASVVEYKGLKASYHCGYCGSEEGKVSCGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEISKGNCEDEPMEPTMDESVAGDFALINKLDIQCDLKTLSDDLKETFESGEKKKGKSPKKEEPKELIQSQHIEEKLGSGEPSHPVKVHMAPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGEPPSLFPPKANKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATFQESYQVYKRYQMVIHQDPPDKPTVSQFTRFLCSSPLEAENPPHGPDCGYGSFHQQYWLDGRIIAVGVIDILPYCVSSVYLYYDPDYSFLSLGVYSALREIGFTRQLHQKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLSLLENSKYCRFNQDPEAVDEGRSKEPDRLQVFHKKAILPYGVYKRQRKAAAEEAAVLQYARLVGQACAERMLLLRN",
        "proteome": "UP000000715",
        "gene": "ATE1",
        "go_terms": [
            {
                "identifier": "GO:0004057",
                "name": "arginyl-tRNA--protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016598",
                "name": "protein arginylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "79c7d9d88ddd90ba9af65e143af6660af705c356",
        "counters": {
            "domain_architectures": 12521,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12521
        }
    }
}