GET /api/protein/UniProt/A0A8S5N2R4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8S5N2R4",
        "id": "A0A8S5N2R4_9CAUD",
        "source_organism": {
            "taxId": "2826569",
            "scientificName": "Podoviridae sp. cti4q9",
            "fullName": "Podoviridae sp. cti4q9"
        },
        "name": "Spanin, inner membrane subunit",
        "description": [
            "Component of the spanin complex that disrupts the host outer membrane and participates in cell lysis during virus exit. The spanin complex conducts the final step in host lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. Host outer membrane disruption is due to local fusion between the inner and outer membrane performed by the spanin complex"
        ],
        "length": 145,
        "sequence": "MSRVTAIISALVICIIVCLSWAVNHYRDNAIAYKEQRDKAASTIADMQKRQRDVAELDARYTKELADANATIESLRADVSAGRKRLQVAATCAKSTTRASGMGDGESPGLTADAELNYYRLRSGIDKITAQVNYLQEYIRTQCLK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0044659",
                "name": "viral release from host cell by cytolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "71c0cf08a44e098109010286f6d4b8122c5d41fa",
        "counters": {
            "domain_architectures": 4908,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4908
        }
    }
}