GET /api/protein/UniProt/A0A8R2ARA2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8R2ARA2",
"id": "A0A8R2ARA2_BOMMO",
"source_organism": {
"taxId": "7091",
"scientificName": "Bombyx mori",
"fullName": "Bombyx mori (Silk moth)"
},
"name": "MICOS complex subunit",
"description": [
"Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane"
],
"length": 249,
"sequence": "MLRKVVMSSMGAIALVPVIKAAAPINEESNGPAKPPPMRVSELPLYETPHADYAEYLEAKAHEQKTSYLKSALLPPVRALREQVQTFVDQTDFIKHSIQDNYHEFQDKSEWIFKYLREEENKEVRYGAVAMGGLTGFIFGLRGGFIRRIIYAGAGTTAMGLVCFPEDTKEIYKNNSVLAKQYINIAYNFLYGVKPGDPQLEVKFPELSLPKDFSEFVEMTVSLASSFKQAVMPPPKEVPEVSKSSEKAE",
"proteome": "UP000005204",
"gene": null,
"go_terms": [
{
"identifier": "GO:0042407",
"name": "cristae formation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0061617",
"name": "MICOS complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d042619ba39886ae04423eab27510f77b2e65e56",
"counters": {
"domain_architectures": 4991,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4991
}
}
}