General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8R2ALK9",
        "id": "A0A8R2ALK9_BOMMO",
        "source_organism": {
            "taxId": "7091",
            "scientificName": "Bombyx mori",
            "fullName": "Bombyx mori (Silk moth)"
        },
        "name": "Deoxyuridine 5'-triphosphate nucleotidohydrolase",
        "description": [
            "Catalyzes the cleavage of 2'-deoxyuridine 5'-triphosphate (dUTP) into 2'-deoxyuridine 5'-monophosphate (dUMP) and inorganic pyrophosphate and through its action efficiently prevents uracil misincorporation into DNA and at the same time provides dUMP, the substrate for de novo thymidylate biosynthesis. Inhibits peroxisome proliferator-activated receptor (PPAR) activity by binding of its N-terminal to PPAR, preventing the latter's dimerization with retinoid X receptor. Essential for embryonic development",
            "Involved in nucleotide metabolism via production of dUMP, the immediate precursor of thymidine nucleotides, and decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA"
        ],
        "length": 147,
        "sequence": "MSGKIQPILKFTRLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPGCYGRVAPRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIAQLICEKIYYPVLQEVANLSVTQRGDGGFGSTGKK",
        "proteome": "UP000005204",
        "gene": "101741979",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004170",
                "name": "dUTP diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006226",
                "name": "dUMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046081",
                "name": "dUTP catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5adb127e6bef47e972ed9845ea1b8804ddd1e9d6",
        "counters": {
            "domain_architectures": 30613,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30613
        }
    }
}