GET /api/protein/UniProt/A0A8R2A6F6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8R2A6F6",
        "id": "A0A8R2A6F6_ACYPI",
        "source_organism": {
            "taxId": "7029",
            "scientificName": "Acyrthosiphon pisum",
            "fullName": "Acyrthosiphon pisum (Pea aphid)"
        },
        "name": "Peroxisomal membrane protein PEX14",
        "description": [
            "Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor. The PEX13-PEX14 docking complex forms a large import pore which can be opened to a diameter of about 9 nm. Mechanistically, PEX5 receptor along with cargo proteins associates with the PEX14 subunit of the PEX13-PEX14 docking complex in the cytosol, leading to the insertion of the receptor into the organelle membrane with the concomitant translocation of the cargo into the peroxisome matrix"
        ],
        "length": 358,
        "sequence": "MMSHNDDKVNSDDNSVAVNAVVNSGDCSAMNNPNTANMAKSTSNNLERNIMVANNSKMPEPIPTVRKSVVAKAIEFLVLESVQKMPTERKINFLSKKGLTDVEIQYSIQRAAMICYDNQSLNKQNQSAHNNSSNAPGAIQTSFESQSWYSRLFGPIAFAAAVVYIGYKLYKKYIESWLFGAQKTPLENRLETIELSVQRCIMMLEEKDNLLKSSNTYADRQKEFNIQVRAELKSIKSLLLNRFQFPPAPASSSIPEWQLLKNTKSQVEQQDKINNSDVPNSLQTSEKSILNETQKNPVVDAQLNGLNGSDNDKDCITINSTSNETPLPTSSNQNLITPKNMDDENDSEHIENNEGINK",
        "proteome": "UP000007819",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016560",
                "name": "protein import into peroxisome matrix, docking",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005778",
                "name": "peroxisomal membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3304e8f7d5fc2f5b87cf8ec1b94fe4bb164f9efb",
        "counters": {
            "domain_architectures": 4672,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4672
        }
    }
}